PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G402700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 606aa    MW: 69040.4 Da    PI: 8.7243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G402700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14.1e-08160204246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++W+  Ed+ l+  v+  G  +W  Ia t+g++Rt+ qc  r+q 
  Aqcoe3G402700.2.p 160 NSWSNTEDKELISIVQNSGIYNWIEIATTLGTNRTPFQCLARYQR 204
                        58*****************************************96 PP

2Myb_DNA-binding42.31.7e-13212258148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++ WT+e+d +l +av+  G ++W  +a+++  +Rt+ qc +rw k l
  Aqcoe3G402700.2.p 212 KQEWTAEDDAQLCEAVEACGENDWQQVASKLE-RRTGVQCSNRWMKTL 258
                        789*****************************.***********9975 PP

3Myb_DNA-binding41.23.7e-13266311248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grWT eEd  l+ av ++ ++ W++Ia+ +  gRt  qc++rw ++l
  Aqcoe3G402700.2.p 266 GRWTVEEDRHLKVAVMLFKPKMWHKIAQFVS-GRTQVQCRERWVNVL 311
                        8******************************.***********9975 PP

4Myb_DNA-binding445e-14318359245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + WT+eEd +l+ a+ ++G   W+++a+ +   Rt++qc+ rw 
  Aqcoe3G402700.2.p 318 QEWTEEEDTKLKAAIVEHGHC-WSKVAASVA-PRTDNQCRRRWK 359
                        57*****************99.*********.9**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.55254153IPR017877Myb-like domain
SMARTSM007170.006658155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-66177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-6126162IPR009057Homeodomain-like
SuperFamilySSF466891.84E-14136203IPR009057Homeodomain-like
PROSITE profilePS500909.036154206IPR017877Myb-like domain
SMARTSM007173.8E-4158208IPR001005SANT/Myb domain
PfamPF002494.9E-6160204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-14163215IPR009057Homeodomain-like
SuperFamilySSF466894.52E-19192261IPR009057Homeodomain-like
PROSITE profilePS5129419.607207262IPR017930Myb domain
SMARTSM007176.3E-14211260IPR001005SANT/Myb domain
PfamPF002491.6E-11212257IPR001005SANT/Myb domain
CDDcd001677.35E-11214258No hitNo description
Gene3DG3DSA:1.10.10.603.6E-16216261IPR009057Homeodomain-like
SMARTSM007176.3E-11264313IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-24264358IPR009057Homeodomain-like
PROSITE profilePS5129410.134264311IPR017930Myb domain
PfamPF002497.2E-12266311IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-16266314IPR009057Homeodomain-like
CDDcd001672.91E-9267311No hitNo description
PROSITE profilePS5129422.3312366IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-18315362IPR009057Homeodomain-like
SMARTSM007176.1E-13316364IPR001005SANT/Myb domain
PfamPF002491.3E-12318359IPR001005SANT/Myb domain
CDDcd001679.03E-12319362No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MLMKKMMILK PLVPLRRGFL YMVLVNDKKL PALFNGPVEN PHVANYRMVL MKFPVSLHRN  60
KWSEKDKENL RRGIEQQFQE MLFQKSVEVY SGADECSGDS NTFDNVVTSI SDIEITPEKI  120
RSFLPKVDWQ RLASMYASGR SGAECETRWV NNEDPLINHN SWSNTEDKEL ISIVQNSGIY  180
NWIEIATTLG TNRTPFQCLA RYQRSLNCHI MKQEWTAEDD AQLCEAVEAC GENDWQQVAS  240
KLERRTGVQC SNRWMKTLNP ARERVGRWTV EEDRHLKVAV MLFKPKMWHK IAQFVSGRTQ  300
VQCRERWVNV LDPSLNLQEW TEEEDTKLKA AIVEHGHCWS KVAASVAPRT DNQCRRRWKI  360
LLPHEVPLLQ AARRIEKSSL ISNFVDREEE RPGLSSSDFL PLPGIDAPEA ENGTSSKEKN  420
TKSSTTTYKA ICEKSPTEAP LSKEASMMIH DDIVEPFGGD DSVSKNKKTH KLQLKRKRCS  480
EPAHVLNQEL PRSLQPSSDG TSSKKKTQPR TPGDGTKGLQ DDSVLADSSR TDVLLTKRRK  540
VPKPPSKRNK STASAKHQEP LSPELPTISR MTALEPTINN SDRSYFTQKE EACSPRQLDD  600
CFKFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-301283583155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-301283583155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243798.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X2
TrEMBLA0A061FVF21e-175A0A061FVF2_THECC; Myb domain protein 4r1, putative isoform 2
TrEMBLA0A068TQ561e-175A0A068TQ56_COFCA; Uncharacterized protein
STRINGGSMUA_Achr9P10150_0011e-171(Musa acuminata)
STRINGPOPTR_0015s04260.11e-169(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-150myb domain protein 4r1